|
|
|
URL: |
taubfamilywineandspiritsservices.com |
IP Address(es): |
208.91.197.27 resolves to 208.91.197.27
|
Loading time: |
0.6100 seconds |
|
|
|
Meta Data |
Title: |
|
robots: | noarchive | googlebot: | nosnippet |
|
|
|
|
|
|
HTTP Headers |
0: | HTTP/1.1 403 Forbidden | Date: | Fri, 17 Jan 2025 00:04:28 GMT | Server: | Apache | Referrer-Policy: | no-referrer-when-downgrade | Accept-CH: | Sec-CH-Save-Data, Sec-CH-DPR, Sec-CH-Width, Sec-CH-Viewport-Width, Sec-CH-Viewport-Height, Sec-CH-Device-Memory, Sec-CH-RTT, Sec-CH-Downlink, Sec-CH-ECT, Sec-CH-Prefers-Color-Scheme, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Model, Sec-CH-UA-Platform-Version | Permissions-Policy: | ch-ua-platform-version=("https://dts.gnpge.com"), ch-ua-model=("https://dts.gnpge.com") | Set-Cookie: | vsid=906vr4846178689542642; expires=Wed, 16-Jan-2030 00:04:28 GMT; Max-Age=157680000; path=/; domain=taubfamilywineandspiritsservices.com; HttpOnly | Content-Length: | 299 | Content-Type: | text/html; charset=UTF-8 |
|
|
|
Hosting Location |
Country: |
Virgin Islands (British) |
|
DNS Records |
|
|
|
More information about taubfamilywineandspiritsservices.com |
|
View cached page from Google |
|
History of taubfamilywineandspiritsservices.com from Wayback Machine |
|
Google Trends for taubfamilywineandspiritsservices.com website |
|
Validate webpage HTML |
|
|
|
|
|
Report Generated on: |
2025-01-16 19:04:07 |
|
|
|
|
|
Best Website: Simple Steps to Successful Websites The Really, Really, Really Easy Step-by-Step Guide to Building Your Own Website: For Absolute Beginners of All Ages |